Lineage for d6jofa_ (6jof A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528466Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2528467Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2528542Family c.116.1.4: tRNA(m1G37)-methyltransferase TrmD [89629] (2 proteins)
    fold and dimerisation mode are similar to those of the YbeA-like family; contains additional C-terminal all-alpha subdomain
  6. 2528555Protein automated matches [196235] (4 species)
    not a true protein
  7. 2528600Species Mycobacterium tuberculosis [TaxId:83332] [365707] (3 PDB entries)
  8. 2528602Domain d6jofa_: 6jof A: [373608]
    automated match to d1oy5a_
    protein/RNA complex; complexed with bwr

Details for d6jofa_

PDB Entry: 6jof (more details), 2.2 Å

PDB Description: crystal structure of trmd from mycobacterium tuberculosis in complex with active-site inhibitor
PDB Compounds: (A:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d6jofa_:

Sequence, based on SEQRES records: (download)

>d6jofa_ c.116.1.4 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mridivtifpacldplrqslpgkaiesglvdlnvhdlrrwthdvhhsvddapygggpgmv
mkapvwgealdeicssetllivptpagvlftqataqrwtteshlvfacgryegidqrvvq
daarrmrveevsigdyvlpggesaavvmveavlrllagvlgnpashqddshstgldglle
gpsytrpaswrgldvpevllsgdhariaawrrevslqrtrerrpdl

Sequence, based on observed residues (ATOM records): (download)

>d6jofa_ c.116.1.4 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mridivtifpacldplrqslpgkaiesglvdlnvhdlrrwthdvhhsvddapygggpgmv
mkapvwgealdeicssetllivptpagvlftqataqrwtteshlvfacgryegidqrvvq
daarrmrveevsigdyvlpggesaavvmveavlrllaglegpsytrpaswrgldvpevll
sgdhariaawrrevslqrtrerrpdl

SCOPe Domain Coordinates for d6jofa_:

Click to download the PDB-style file with coordinates for d6jofa_.
(The format of our PDB-style files is described here.)

Timeline for d6jofa_: