SCOPe 2.08: Domain d6jofa_: 6jof A:

Lineage for d6jofa_ (6jof A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.4: tRNA(m1G37)-methyltransferase TrmD [89629] (2 proteins)
   fold and dimerisation mode are similar to those of the YbeA-like family; contains additional C-terminal all-alpha subdomain

6. Protein automated matches [196235] (4 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [365707] (3 PDB entries)

8. Domain d6jofa_: 6jof A: [373608]
   automated match to d1oy5a_
   protein/RNA complex; complexed with bwr

Details for d6jofa_

PDB Entry: 6jof, 2.2 Å

PDB Description: crystal structure of trmd from mycobacterium tuberculosis in complex with active-site inhibitor

PDB Compounds: (A:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d6jofa_:

Sequence, based on SEQRES records:

>d6jofa_ c.116.1.4 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mridivtifpacldplrqslpgkaiesglvdlnvhdlrrwthdvhhsvddapygggpgmv
mkapvwgealdeicssetllivptpagvlftqataqrwtteshlvfacgryegidqrvvq
daarrmrveevsigdyvlpggesaavvmveavlrllagvlgnpashqddshstgldglle
gpsytrpaswrgldvpevllsgdhariaawrrevslqrtrerrpdl

Sequence, based on observed residues (ATOM records):

>d6jofa_ c.116.1.4 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mridivtifpacldplrqslpgkaiesglvdlnvhdlrrwthdvhhsvddapygggpgmv
mkapvwgealdeicssetllivptpagvlftqataqrwtteshlvfacgryegidqrvvq
daarrmrveevsigdyvlpggesaavvmveavlrllaglegpsytrpaswrgldvpevll
sgdhariaawrrevslqrtrerrpdl

Timeline for d6jofa_:

• d6jofa_ first appeared in SCOPe 2.07