Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.84: Subtilisin inhibitor [55398] (1 superfamily) alpha+beta sandwich |
Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families) |
Family d.84.1.0: automated matches [193339] (1 protein) not a true family |
Protein automated matches [193340] (2 species) not a true protein |
Species Streptomyces mobaraensis [TaxId:1223523] [373584] (1 PDB entry) |
Domain d6i0ia_: 6i0i A: [373595] automated match to d2tldi_ |
PDB Entry: 6i0i (more details), 1.45 Å
SCOPe Domain Sequences for d6i0ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i0ia_ d.84.1.0 (A:) automated matches {Streptomyces mobaraensis [TaxId: 1223523]} yapsalvltvgqgdkaasagvqravtlncmpkpsgthpdargacdqlraasgnfaeitki ksgtactkewnpfvvtaegvwegqrvkyehtfanpcemkagkgtvfef
Timeline for d6i0ia_: