SCOPe 2.07: Domain d6i0ia_: 6i0i A:

Lineage for d6i0ia_ (6i0i A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.84: Subtilisin inhibitor [55398] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families)

5. Family d.84.1.0: automated matches [193339] (1 protein)
   not a true family

6. Protein automated matches [193340] (2 species)
   not a true protein

7. Species Streptomyces mobaraensis [TaxId:1223523] [373584] (1 PDB entry)

8. Domain d6i0ia_: 6i0i A: [373595]
   automated match to d2tldi_

Details for d6i0ia_

PDB Entry: 6i0i, 1.45 Å

PDB Description: structure of the streptomyces subtilisin and tamp inhibitor (ssti)

PDB Compounds: (A:) Transglutaminase-activating metalloprotease inhibitor

SCOPe Domain Sequences for d6i0ia_:

Sequence; same for both SEQRES and ATOM records:

>d6i0ia_ d.84.1.0 (A:) automated matches {Streptomyces mobaraensis [TaxId: 1223523]}
yapsalvltvgqgdkaasagvqravtlncmpkpsgthpdargacdqlraasgnfaeitki
ksgtactkewnpfvvtaegvwegqrvkyehtfanpcemkagkgtvfef

Timeline for d6i0ia_:

• d6i0ia_ is new in SCOPe 2.07-stable
  
• d6i0ia_ appears in the current release, SCOPe 2.08