Lineage for d6i0ia_ (6i0i A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962415Fold d.84: Subtilisin inhibitor [55398] (1 superfamily)
    alpha+beta sandwich
  4. 2962416Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families) (S)
  5. 2962426Family d.84.1.0: automated matches [193339] (1 protein)
    not a true family
  6. 2962427Protein automated matches [193340] (2 species)
    not a true protein
  7. 2962438Species Streptomyces mobaraensis [TaxId:1223523] [373584] (1 PDB entry)
  8. 2962439Domain d6i0ia_: 6i0i A: [373595]
    automated match to d2tldi_

Details for d6i0ia_

PDB Entry: 6i0i (more details), 1.45 Å

PDB Description: structure of the streptomyces subtilisin and tamp inhibitor (ssti)
PDB Compounds: (A:) Transglutaminase-activating metalloprotease inhibitor

SCOPe Domain Sequences for d6i0ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i0ia_ d.84.1.0 (A:) automated matches {Streptomyces mobaraensis [TaxId: 1223523]}
yapsalvltvgqgdkaasagvqravtlncmpkpsgthpdargacdqlraasgnfaeitki
ksgtactkewnpfvvtaegvwegqrvkyehtfanpcemkagkgtvfef

SCOPe Domain Coordinates for d6i0ia_:

Click to download the PDB-style file with coordinates for d6i0ia_.
(The format of our PDB-style files is described here.)

Timeline for d6i0ia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6i0ib_