Lineage for d1icwb_ (1icw B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188772Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 188773Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 188774Family d.9.1.1: Interleukin 8-like chemokines [54118] (22 proteins)
  6. 188811Protein Interleukin-8, IL-8 [54119] (1 species)
  7. 188812Species Human (Homo sapiens) [TaxId:9606] [54120] (9 PDB entries)
  8. 188815Domain d1icwb_: 1icw B: [37358]

Details for d1icwb_

PDB Entry: 1icw (more details), 2.01 Å

PDB Description: interleukin-8, mutant with glu 38 replaced by cys and cys 50 replaced by ala

SCOP Domain Sequences for d1icwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1icwb_ d.9.1.1 (B:) Interleukin-8, IL-8 {Human (Homo sapiens)}
cqciktyskpfhpkfikelrviesgphcantciivklsdgrelaldpkenwvqrvvekfl
kraens

SCOP Domain Coordinates for d1icwb_:

Click to download the PDB-style file with coordinates for d1icwb_.
(The format of our PDB-style files is described here.)

Timeline for d1icwb_:

188815
d1icwb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1icwa_