Lineage for d6tyaa_ (6tya A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794586Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2794786Protein automated matches [190306] (9 species)
    not a true protein
  7. 2794836Species Staphylococcus epidermidis [TaxId:176280] [227720] (6 PDB entries)
  8. 2794840Domain d6tyaa_: 6tya A: [373567]
    automated match to d4jcna_

Details for d6tyaa_

PDB Entry: 6tya (more details), 2.07 Å

PDB Description: structure of n-terminus locked esp with one pro-peptide residue - v67c, d255c
PDB Compounds: (A:) Glutamyl endopeptidase

SCOPe Domain Sequences for d6tyaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tyaa_ b.47.1.1 (A:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
scilpnnnrhqifnttqghydavsfiyipidggymsgsgvvvgeneiltnkhvvngakgn
prnisvhpsaknendypngkfvgqeiipypgnsdlailrvspnehnqhigqvvkpatiss
ntdtrinenitvtgypgdkplatmwesvgkvvyiggeelrydlstvggnsgspvfngknq
vigihyggvcnkynssvyindfvqqflrnnipdiniq

SCOPe Domain Coordinates for d6tyaa_:

Click to download the PDB-style file with coordinates for d6tyaa_.
(The format of our PDB-style files is described here.)

Timeline for d6tyaa_: