Lineage for d6u2ha_ (6u2h A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333633Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2333634Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2333684Protein automated matches [190238] (9 species)
    not a true protein
  7. 2333688Species Cow (Bos taurus) [TaxId:9913] [187212] (2 PDB entries)
  8. 3073498Domain d6u2ha_: 6u2h A: [373560]
    Other proteins in same PDB: d6u2hb2, d6u2hc_, d6u2hd_
    automated match to d2v7da_
    complexed with 29l

Details for d6u2ha_

PDB Entry: 6u2h (more details), 2.5 Å

PDB Description: braf dimer bound to 14-3-3
PDB Compounds: (A:) 14-3-3 protein zeta/delta

SCOPe Domain Sequences for d6u2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u2ha_ a.118.7.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

SCOPe Domain Coordinates for d6u2ha_:

Click to download the PDB-style file with coordinates for d6u2ha_.
(The format of our PDB-style files is described here.)

Timeline for d6u2ha_: