Lineage for d3il8__ (3il8 -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30036Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 30037Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 30038Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 proteins)
  6. 30071Protein Interleukin-8, IL-8 [54119] (1 species)
  7. 30072Species Human (Homo sapiens) [TaxId:9606] [54120] (9 PDB entries)
  8. 30073Domain d3il8__: 3il8 - [37356]

Details for d3il8__

PDB Entry: 3il8 (more details), 2 Å

PDB Description: crystal structure of interleukin 8: symbiosis of nmr and crystallography

SCOP Domain Sequences for d3il8__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3il8__ d.9.1.1 (-) Interleukin-8, IL-8 {Human (Homo sapiens)}
lrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrvvek
flkraens

SCOP Domain Coordinates for d3il8__:

Click to download the PDB-style file with coordinates for d3il8__.
(The format of our PDB-style files is described here.)

Timeline for d3il8__: