Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) alpha(3)-beta(2); antiparallel hairpin |
Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) |
Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein) |
Protein Urease, gamma-subunit [54113] (3 species) |
Species Bacillus pasteurii [TaxId:1474] [54115] (5 PDB entries) |
Domain d2ubpa_: 2ubp A: [37354] Other proteins in same PDB: d2ubpb_, d2ubpc1, d2ubpc2 |
PDB Entry: 2ubp (more details), 2 Å
SCOP Domain Sequences for d2ubpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ubpa_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii} mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
Timeline for d2ubpa_: