![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) alpha(3)-beta(2); antiparallel hairpin |
![]() | Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) ![]() |
![]() | Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein) |
![]() | Protein Urease, gamma-subunit [54113] (3 species) |
![]() | Species Bacillus pasteurii [TaxId:1474] [54115] (5 PDB entries) |
![]() | Domain d2ubpa_: 2ubp A: [37354] Other proteins in same PDB: d2ubpb_, d2ubpc1, d2ubpc2 |
PDB Entry: 2ubp (more details), 2 Å
SCOP Domain Sequences for d2ubpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ubpa_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii} mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
Timeline for d2ubpa_: