Lineage for d1ubpa_ (1ubp A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 498812Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 498813Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) (S)
  5. 498814Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 498815Protein Urease, gamma-subunit [54113] (3 species)
  7. 498816Species Bacillus pasteurii [TaxId:1474] [54115] (6 PDB entries)
  8. 498818Domain d1ubpa_: 1ubp A: [37353]
    Other proteins in same PDB: d1ubpb_, d1ubpc1, d1ubpc2

Details for d1ubpa_

PDB Entry: 1ubp (more details), 1.65 Å

PDB Description: crystal structure of urease from bacillus pasteurii inhibited with beta-mercaptoethanol at 1.65 angstroms resolution

SCOP Domain Sequences for d1ubpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubpa_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii}
mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

SCOP Domain Coordinates for d1ubpa_:

Click to download the PDB-style file with coordinates for d1ubpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ubpa_: