Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) |
Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) |
Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein) |
Protein Urease, gamma-subunit [54113] (3 species) |
Species Bacillus pasteurii [TaxId:1474] [54115] (5 PDB entries) |
Domain d1ubpa_: 1ubp A: [37353] Other proteins in same PDB: d1ubpb_, d1ubpc1, d1ubpc2 |
PDB Entry: 1ubp (more details), 1.65 Å
SCOP Domain Sequences for d1ubpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ubpa_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii} mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
Timeline for d1ubpa_: