SCOP 1.67: Domain d4ubpa_: 4ubp A:

Lineage for d4ubpa_ (4ubp A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family)

5. Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)

6. Protein Urease, gamma-subunit [54113] (3 species)

7. Species Bacillus pasteurii [TaxId:1474] [54115] (6 PDB entries)

8. Domain d4ubpa_: 4ubp A: [37352]
   Other proteins in same PDB: d4ubpb_, d4ubpc1, d4ubpc2
   complexed with ace, hae, ni

Details for d4ubpa_

PDB Entry: 4ubp, 1.55 Å

PDB Description: structure of bacillus pasteurii urease inhibited with acetohydroxamic acid at 1.55 a resolution

SCOP Domain Sequences for d4ubpa_:

Sequence; same for both SEQRES and ATOM records:

>d4ubpa_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii}
mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

Timeline for d4ubpa_:

• d4ubpa_ first appeared (with stable ids) in SCOP 1.55
  
• d4ubpa_ appears in SCOP 1.65
  
• d4ubpa_ appears in SCOP 1.69
  
• d4ubpa_ appears in the current release, SCOPe 2.08