Lineage for d4ubpa_ (4ubp A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188733Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
  4. 188734Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) (S)
  5. 188735Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 188736Protein Urease, gamma-subunit [54113] (3 species)
  7. 188737Species Bacillus pasteurii [TaxId:1474] [54115] (5 PDB entries)
  8. 188738Domain d4ubpa_: 4ubp A: [37352]
    Other proteins in same PDB: d4ubpb_, d4ubpc1, d4ubpc2

Details for d4ubpa_

PDB Entry: 4ubp (more details), 1.55 Å

PDB Description: structure of bacillus pasteurii urease inhibited with acetohydroxamic acid at 1.55 a resolution

SCOP Domain Sequences for d4ubpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ubpa_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii}
mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

SCOP Domain Coordinates for d4ubpa_:

Click to download the PDB-style file with coordinates for d4ubpa_.
(The format of our PDB-style files is described here.)

Timeline for d4ubpa_: