SCOPe 2.04: Domain d1a5oa_: 1a5o A:

Lineage for d1a5oa_ (1a5o A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families)

5. Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
   automatically mapped to Pfam PF00547

6. Protein Urease, gamma-subunit [54113] (4 species)

7. Species Klebsiella aerogenes [TaxId:28451] [54114] (27 PDB entries)

8. Domain d1a5oa_: 1a5o A: [37351]
   Other proteins in same PDB: d1a5ob_, d1a5oc1, d1a5oc2
   complexed with fmt, ni

Details for d1a5oa_

PDB Entry: 1a5o, 2.5 Å

PDB Description: k217c variant of klebsiella aerogenes urease, chemically rescued by formate and nickel

PDB Compounds: (A:) urease (gamma subunit)

SCOPe Domain Sequences for d1a5oa_:

Sequence; same for both SEQRES and ATOM records:

>d1a5oa_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes [TaxId: 28451]}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

Timeline for d1a5oa_:

• d1a5oa_ first appeared (with stable ids) in SCOP 1.55
  
• d1a5oa_ appears in SCOPe 2.03
  
• d1a5oa_ appears in SCOPe 2.05
  
• d1a5oa_ appears in the current release, SCOPe 2.08