Lineage for d1a5oa_ (1a5o A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30001Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
  4. 30002Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) (S)
  5. 30003Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 30004Protein Urease, gamma-subunit [54113] (2 species)
  7. 30010Species Klebsiella aerogenes [TaxId:28451] [54114] (25 PDB entries)
  8. 30035Domain d1a5oa_: 1a5o A: [37351]
    Other proteins in same PDB: d1a5ob_, d1a5oc1, d1a5oc2

Details for d1a5oa_

PDB Entry: 1a5o (more details), 2.5 Å

PDB Description: k217c variant of klebsiella aerogenes urease, chemically rescued by formate and nickel

SCOP Domain Sequences for d1a5oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5oa_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

SCOP Domain Coordinates for d1a5oa_:

Click to download the PDB-style file with coordinates for d1a5oa_.
(The format of our PDB-style files is described here.)

Timeline for d1a5oa_: