Lineage for d1krca_ (1krc A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130449Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
  4. 130450Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) (S)
  5. 130451Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 130452Protein Urease, gamma-subunit [54113] (3 species)
  7. 130462Species Klebsiella aerogenes [TaxId:28451] [54114] (25 PDB entries)
  8. 130486Domain d1krca_: 1krc A: [37350]
    Other proteins in same PDB: d1krcb_, d1krcc1, d1krcc2

Details for d1krca_

PDB Entry: 1krc (more details), 2.5 Å

PDB Description: crystal structure of klebsiella aerogenes urease, its apoenzyme and two active site mutants

SCOP Domain Sequences for d1krca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krca_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

SCOP Domain Coordinates for d1krca_:

Click to download the PDB-style file with coordinates for d1krca_.
(The format of our PDB-style files is described here.)

Timeline for d1krca_: