Lineage for d6p8wa1 (6p8w A:1-168)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480081Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries)
  8. 2480276Domain d6p8wa1: 6p8w A:1-168 [373494]
    Other proteins in same PDB: d6p8wa2, d6p8wb2
    automated match to d2iezb_
    complexed with ca, gdp, o67

Details for d6p8wa1

PDB Entry: 6p8w (more details), 2.1 Å

PDB Description: crystal structure of human kras g12c covalently bound to an acryloylazetidine acetamide inhibitor.
PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d6p8wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p8wa1 c.37.1.0 (A:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildtag
qeeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

SCOPe Domain Coordinates for d6p8wa1:

Click to download the PDB-style file with coordinates for d6p8wa1.
(The format of our PDB-style files is described here.)

Timeline for d6p8wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6p8wa2