Lineage for d6heta_ (6het A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein automated matches [190091] (20 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188447] (844 PDB entries)
  8. Domain d6heta_: 6het A: [373491]
    automated match to d2jiub_
    complexed with g0q

Details for d6heta_

PDB Entry: 6het (more details), 1.21 Å

PDB Description: crystal structure of ephrin a2 (epha2) receptor protein kinase with the nvp-bhg712 derivative at055
PDB Compounds: (A:) Ephrin type-A receptor 2

SCOPe Domain Sequences for d6heta_:

Sequence, based on SEQRES records: (download)

>d6heta_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tteihpscvtrqkvigagefgevykgmlktssgkkevpvaiktlkagytekqrvdflgea
gimgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvlqlvgmlrgia
agmkylanmnyvhrdlaarnilvnsnlvckvsdfglsrvleddpeatyttsggkipirwt
apeaisyrkftsasdvwsfgivmwevmtygerpywelsnhevmkaindgfrlptpmdcps
aiyqlmmqcwqqerarrpkfadivsildklirapdslktladfdprvsirlp

Sequence, based on observed residues (ATOM records): (download)

>d6heta_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tteihpscvtrqkvigagefgevykgmlktevpvaiktlkagytekqrvdflgeagimgq
fshhniirlegviskykpmmiiteymengaldkflrekdgefsvlqlvgmlrgiaagmky
lanmnyvhrdlaarnilvnsnlvckvsdfglpirwtapeaisyrkftsasdvwsfgivmw
evmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmmqcwqqerarrpkfadiv
sildklirapdslktladfdprvsirlp

SCOPe Domain Coordinates for d6heta_ are not available.

Timeline for d6heta_: