Lineage for d1krba_ (1krb A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77380Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
  4. 77381Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) (S)
  5. 77382Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 77383Protein Urease, gamma-subunit [54113] (2 species)
  7. 77390Species Klebsiella aerogenes [TaxId:28451] [54114] (25 PDB entries)
  8. 77413Domain d1krba_: 1krb A: [37349]
    Other proteins in same PDB: d1krbb_, d1krbc1, d1krbc2

Details for d1krba_

PDB Entry: 1krb (more details), 2.5 Å

PDB Description: crystal structure of klebsiella aerogenes urease, its apoenzyme and two active site mutants

SCOP Domain Sequences for d1krba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krba_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

SCOP Domain Coordinates for d1krba_:

Click to download the PDB-style file with coordinates for d1krba_.
(The format of our PDB-style files is described here.)

Timeline for d1krba_: