Lineage for d6hdud1 (6hdu D:1-181)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (156 species)
    not a true protein
  7. 2452278Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries)
  8. 3073424Domain d6hdud1: 6hdu D:1-181 [373486]
    Other proteins in same PDB: d6hdua2, d6hdub2, d6hdud2
    automated match to d2j0vb_
    complexed with gtp, mg

Details for d6hdud1

PDB Entry: 6hdu (more details), 1.79 Å

PDB Description: crystal structure of human rab38 in complex with gtp
PDB Compounds: (D:) Ras-related protein Rab-38

SCOPe Domain Sequences for d6hdud1:

Sequence, based on SEQRES records: (download)

>d6hdud1 c.37.1.0 (D:1-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqaphkehlykllvigdlgvgktsiikryvhqnfsshyratigvdfalkvlhwdpetvvr
lqlwdiaglerfgnmtrvyyreamgafivfdvtrpatfeavakwkndldsklslpngkpv
svvllankcdqgkdvlmnnglkmdqfckehgfvgwfetsakeninideasrclvkhilan
e

Sequence, based on observed residues (ATOM records): (download)

>d6hdud1 c.37.1.0 (D:1-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqaphkehlykllvigdlgvgktsiikryvhqnfsshyratigvdfalkvlhwdpetvvr
lqlwdiaglerfgnmtrvyyreamgafivfdvtrpatfeavakwkndldsklslpngkpv
svvllankcdqkmdqfckehgfvgwfetsakeninideasrclvkhilane

SCOPe Domain Coordinates for d6hdud1:

Click to download the PDB-style file with coordinates for d6hdud1.
(The format of our PDB-style files is described here.)

Timeline for d6hdud1:

  • d6hdud1 is new in SCOPe 2.07-stable