SCOPe 2.04: Domain d1ef2c_: 1ef2 C:

Lineage for d1ef2c_ (1ef2 C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families)

5. Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
   automatically mapped to Pfam PF00547

6. Protein Urease, gamma-subunit [54113] (4 species)

7. Species Klebsiella aerogenes [TaxId:28451] [54114] (27 PDB entries)

8. Domain d1ef2c_: 1ef2 C: [37348]
   Other proteins in same PDB: d1ef2a1, d1ef2a2, d1ef2b_
   complexed with mn

Details for d1ef2c_

PDB Entry: 1ef2, 2.5 Å

PDB Description: crystal structure of manganese-substituted klebsiella aerogenes urease

PDB Compounds: (C:) urease gamma subunit

SCOPe Domain Sequences for d1ef2c_:

Sequence; same for both SEQRES and ATOM records:

>d1ef2c_ d.8.1.1 (C:) Urease, gamma-subunit {Klebsiella aerogenes [TaxId: 28451]}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

Timeline for d1ef2c_:

• d1ef2c_ first appeared (with stable ids) in SCOP 1.55
  
• d1ef2c_ appears in SCOPe 2.03
  
• d1ef2c_ appears in SCOPe 2.05
  
• d1ef2c_ appears in the current release, SCOPe 2.08