Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) alpha(3)-beta(2); antiparallel hairpin |
Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) |
Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein) automatically mapped to Pfam PF00547 |
Protein Urease, gamma-subunit [54113] (4 species) |
Species Klebsiella aerogenes [TaxId:28451] [54114] (27 PDB entries) |
Domain d1ef2c_: 1ef2 C: [37348] Other proteins in same PDB: d1ef2a1, d1ef2a2, d1ef2b_ complexed with mn |
PDB Entry: 1ef2 (more details), 2.5 Å
SCOPe Domain Sequences for d1ef2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ef2c_ d.8.1.1 (C:) Urease, gamma-subunit {Klebsiella aerogenes [TaxId: 28451]} meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii
Timeline for d1ef2c_: