Lineage for d1ejva_ (1ejv A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2156426Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 2156427Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 2156428Family d.8.1.1: Urease, gamma-subunit [54112] (2 protein domains)
    automatically mapped to Pfam PF00547
  6. 2156429Protein Urease, gamma-subunit [54113] (4 species)
  7. 2156448Species Klebsiella aerogenes [TaxId:28451] [54114] (28 PDB entries)
  8. 2156472Domain d1ejva_: 1ejv A: [37347]
    Other proteins in same PDB: d1ejvb_, d1ejvc1, d1ejvc2
    complexed with ni

Details for d1ejva_

PDB Entry: 1ejv (more details), 2.4 Å

PDB Description: crystal structure of the h320q variant of klebsiella aerogenes urease
PDB Compounds: (A:) urease gamma subunit

SCOPe Domain Sequences for d1ejva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejva_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes [TaxId: 28451]}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

SCOPe Domain Coordinates for d1ejva_:

Click to download the PDB-style file with coordinates for d1ejva_.
(The format of our PDB-style files is described here.)

Timeline for d1ejva_: