Lineage for d6heua_ (6heu A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983276Protein automated matches [190091] (20 species)
    not a true protein
  7. 2983389Species Human (Homo sapiens) [TaxId:9606] [188447] (849 PDB entries)
  8. 2983746Domain d6heua_: 6heu A: [373450]
    automated match to d2jiub_
    complexed with g0n

Details for d6heua_

PDB Entry: 6heu (more details), 1.72 Å

PDB Description: crystal structure of ephrin a2 (epha2) receptor protein kinase with the nvp-bhg712 derivative at058
PDB Compounds: (A:) Ephrin type-A receptor 2

SCOPe Domain Sequences for d6heua_:

Sequence, based on SEQRES records: (download)

>d6heua_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avlkftteihpscvtrqkvigagefgevykgmlktssgkkevpvaiktlkagytekqrvd
flgeagimgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvlqlvgm
lrgiaagmkylanmnyvhrdlaarnilvnsnlvckvsdfglsrvleddpeatyttsggki
pirwtapeaisyrkftsasdvwsfgivmwevmtygerpywelsnhevmkaindgfrlptp
mdcpsaiyqlmmqcwqqerarrpkfadivsildklirapdslktladfdprvsirlp

Sequence, based on observed residues (ATOM records): (download)

>d6heua_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avlkftteihpscvtrqkvigagefgevykgmlktkevpvaiktlkagytekqrvdflge
agimgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvlqlvgmlrgi
aagmkylanmnyvhrdlaarnilvnsnlvckvsdfglspirwtapeaisyrkftsasdvw
sfgivmwevmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmmqcwqqerarr
pkfadivsildklirapdslktladfdprvsirlp

SCOPe Domain Coordinates for d6heua_:

Click to download the PDB-style file with coordinates for d6heua_.
(The format of our PDB-style files is described here.)

Timeline for d6heua_: