Lineage for d6k9ve_ (6k9v E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339505Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2339704Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2339705Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2339706Protein Stathmin 4 [101496] (2 species)
  7. 2339707Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (103 PDB entries)
  8. 3073380Domain d6k9ve_: 6k9v E: [373442]
    Other proteins in same PDB: d6k9va1, d6k9va2, d6k9vb1, d6k9vb2, d6k9vc1, d6k9vc2, d6k9vd1, d6k9vd2, d6k9vf1, d6k9vf2, d6k9vf3
    automated match to d4i55e_
    complexed with acp, ca, d3l, gdp, gtp, mes, mg

Details for d6k9ve_

PDB Entry: 6k9v (more details), 2.54 Å

PDB Description: crystal structure of tubulin in complex with inhibitor d64
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d6k9ve_:

Sequence, based on SEQRES records: (download)

>d6k9ve_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d6k9ve_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

SCOPe Domain Coordinates for d6k9ve_:

Click to download the PDB-style file with coordinates for d6k9ve_.
(The format of our PDB-style files is described here.)

Timeline for d6k9ve_:

  • d6k9ve_ appears in periodic updates to SCOPe 2.07 starting on 2019-08-29