SCOPe 2.08: Domain d6k9ve_: 6k9v E:

Lineage for d6k9ve_ (6k9v E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)

8. Domain d6k9ve_: 6k9v E: [373442]
   Other proteins in same PDB: d6k9va1, d6k9va2, d6k9vb1, d6k9vb2, d6k9vc1, d6k9vc2, d6k9vd1, d6k9vd2, d6k9vf1, d6k9vf2, d6k9vf3
   automated match to d4i55e_
   complexed with acp, ca, d3l, gdp, gtp, mes, mg

Details for d6k9ve_

PDB Entry: 6k9v, 2.54 Å

PDB Description: crystal structure of tubulin in complex with inhibitor d64

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d6k9ve_:

Sequence, based on SEQRES records:

>d6k9ve_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records):

>d6k9ve_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

Timeline for d6k9ve_:

• d6k9ve_ first appeared in SCOPe 2.07