Lineage for d6k9vb2 (6k9v B:244-428)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525532Species Cow (Bos taurus) [TaxId:9913] [226565] (78 PDB entries)
  8. 3073376Domain d6k9vb2: 6k9v B:244-428 [373438]
    Other proteins in same PDB: d6k9va1, d6k9vb1, d6k9vc1, d6k9vd1, d6k9ve_, d6k9vf1, d6k9vf2, d6k9vf3
    automated match to d3rycd2
    complexed with acp, ca, d3l, gdp, gtp, mes, mg

Details for d6k9vb2

PDB Entry: 6k9v (more details), 2.54 Å

PDB Description: crystal structure of tubulin in complex with inhibitor d64
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6k9vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k9vb2 d.79.2.1 (B:244-428) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

SCOPe Domain Coordinates for d6k9vb2:

Click to download the PDB-style file with coordinates for d6k9vb2.
(The format of our PDB-style files is described here.)

Timeline for d6k9vb2: