Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries) |
Domain d6k9vb2: 6k9v B:244-428 [373438] Other proteins in same PDB: d6k9va1, d6k9vb1, d6k9vc1, d6k9vd1, d6k9ve_, d6k9vf1, d6k9vf2, d6k9vf3 automated match to d3rycd2 complexed with acp, ca, d3l, gdp, gtp, mes, mg |
PDB Entry: 6k9v (more details), 2.54 Å
SCOPe Domain Sequences for d6k9vb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k9vb2 d.79.2.1 (B:244-428) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqda
Timeline for d6k9vb2: