SCOPe 2.07: Domain d6k9vb1: 6k9v B:2-243

Lineage for d6k9vb1 (6k9v B:2-243)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (10 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (128 PDB entries)

8. Domain d6k9vb1: 6k9v B:2-243 [373437]
   Other proteins in same PDB: d6k9va2, d6k9vb2, d6k9vc2, d6k9vd2, d6k9ve_, d6k9vf1, d6k9vf2, d6k9vf3
   automated match to d4drxb1
   complexed with acp, ca, d3l, gdp, gtp, mes, mg

Details for d6k9vb1

PDB Entry: 6k9v, 2.54 Å

PDB Description: crystal structure of tubulin in complex with inhibitor d64

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6k9vb1:

Sequence; same for both SEQRES and ATOM records:

>d6k9vb1 c.32.1.1 (B:2-243) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d6k9vb1:

• d6k9vb1 is new in SCOPe 2.07-stable
  
• d6k9vb1 appears in the current release, SCOPe 2.08