SCOPe 2.08: Domain d6hc1a_: 6hc1 A:

Lineage for d6hc1a_ (6hc1 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.0: automated matches [191616] (1 protein)
   not a true family

6. Protein automated matches [191125] (8 species)
   not a true protein

7. Species Bdellovibrio bacteriovorus [TaxId:264462] [373359] (2 PDB entries)

8. Domain d6hc1a_: 6hc1 A: [373434]
   automated match to d1r21a_

Details for d6hc1a_

PDB Entry: 6hc1, 1.49 Å

PDB Description: bdellovibrio bacteriovorus dgcb fha in complex with phosphorylated n- terminal peptide

PDB Compounds: (A:) GGDEF domain protein

SCOPe Domain Sequences for d6hc1a_:

Sequence; same for both SEQRES and ATOM records:

>d6hc1a_ b.26.1.0 (A:) automated matches {Bdellovibrio bacteriovorus [TaxId: 264462]}
mppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
dlgstnktivngqvipplascllknndqiktgnvifkflekgs

Timeline for d6hc1a_:

• d6hc1a_ first appeared in SCOPe 2.07