Lineage for d6hc1b_ (6hc1 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2372848Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2372849Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2372984Family b.26.1.0: automated matches [191616] (1 protein)
    not a true family
  6. 2372985Protein automated matches [191125] (8 species)
    not a true protein
  7. 3073297Species Bdellovibrio bacteriovorus [TaxId:264462] [373359] (2 PDB entries)
  8. 3073368Domain d6hc1b_: 6hc1 B: [373430]
    automated match to d1r21a_

Details for d6hc1b_

PDB Entry: 6hc1 (more details), 1.49 Å

PDB Description: bdellovibrio bacteriovorus dgcb fha in complex with phosphorylated n- terminal peptide
PDB Compounds: (B:) GGDEF domain protein

SCOPe Domain Sequences for d6hc1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hc1b_ b.26.1.0 (B:) automated matches {Bdellovibrio bacteriovorus [TaxId: 264462]}
mppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
dlgstnktivngqvipplascllknndqiktgnvifkflekg

SCOPe Domain Coordinates for d6hc1b_:

Click to download the PDB-style file with coordinates for d6hc1b_.
(The format of our PDB-style files is described here.)

Timeline for d6hc1b_:

  • d6hc1b_ is new in SCOPe 2.07-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d6hc1a_