SCOPe 2.07: Domain d6adbe1: 6adb E:2-121

Lineage for d6adbe1 (6adb E:2-121)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (61 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d6adbe1: 6adb E:2-121 [373428]
   Other proteins in same PDB: d6adba_, d6adbb_, d6adbc2, d6adbd1, d6adbd2, d6adbe2, d6adbf1, d6adbf2
   automated match to d1otsc1
   complexed with br; mutant

Details for d6adbe1

PDB Entry: 6adb, 2.69 Å

PDB Description: crystal structure of the e148n mutant clc-ec1 in 20mm bromide

PDB Compounds: (E:) antibody fab fragment, heavy chain

SCOPe Domain Sequences for d6adbe1:

Sequence; same for both SEQRES and ATOM records:

>d6adbe1 b.1.1.1 (E:2-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss

Timeline for d6adbe1:

• d6adbe1 is new in SCOPe 2.07-stable
  
• d6adbe1 appears in the current release, SCOPe 2.08