SCOPe 2.02: Domain d1fwja_: 1fwj A:

Lineage for d1fwja_ (1fwj A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families)

5. Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)

6. Protein Urease, gamma-subunit [54113] (4 species)

7. Species Klebsiella aerogenes [TaxId:28451] [54114] (27 PDB entries)

8. Domain d1fwja_: 1fwj A: [37342]
   Other proteins in same PDB: d1fwjb_, d1fwjc1, d1fwjc2
   complexed with ni

Details for d1fwja_

PDB Entry: 1fwj, 2.2 Å

PDB Description: klebsiella aerogenes urease, native

PDB Compounds: (A:) urease

SCOPe Domain Sequences for d1fwja_:

Sequence; same for both SEQRES and ATOM records:

>d1fwja_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes [TaxId: 28451]}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

Timeline for d1fwja_:

• d1fwja_ first appeared (with stable ids) in SCOP 1.55
  
• d1fwja_ appears in SCOPe 2.01
  
• d1fwja_ appears in SCOPe 2.03
  
• d1fwja_ appears in the current release, SCOPe 2.08