Lineage for d6adbb_ (6adb B:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629845Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 2629846Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 2629847Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 2629895Protein automated matches [226846] (4 species)
    not a true protein
  7. 2629925Species Escherichia coli [TaxId:216592] [255982] (7 PDB entries)
  8. 2629929Domain d6adbb_: 6adb B: [373415]
    Other proteins in same PDB: d6adbc1, d6adbc2, d6adbd1, d6adbd2, d6adbe1, d6adbe2, d6adbf1, d6adbf2
    automated match to d3nmoa_
    complexed with br; mutant

Details for d6adbb_

PDB Entry: 6adb (more details), 2.69 Å

PDB Description: crystal structure of the e148n mutant clc-ec1 in 20mm bromide
PDB Compounds: (B:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d6adbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6adbb_ f.20.1.1 (B:) automated matches {Escherichia coli [TaxId: 216592]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgrngptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplysailartlakqea

SCOPe Domain Coordinates for d6adbb_:

Click to download the PDB-style file with coordinates for d6adbb_.
(The format of our PDB-style files is described here.)

Timeline for d6adbb_: