Class b: All beta proteins [48724] (180 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (20 species) not a true protein |
Species Staphylococcus phage [TaxId:12360] [227850] (3 PDB entries) |
Domain d6h4ce_: 6h4c E: [373410] automated match to d3zeza_ complexed with mg, ni, peg |
PDB Entry: 6h4c (more details), 2.52 Å
SCOPe Domain Sequences for d6h4ce_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h4ce_ b.85.4.0 (E:) automated matches {Staphylococcus phage [TaxId: 12360]} mtntlqvrllsenarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgl ltsrsgvsskthlvietgkidagyhgnlginikndaiasngyitpgvfdikgeidlsdai rqygtyqinegdklaqlvivpiwtpelkqveefe
Timeline for d6h4ce_: