SCOPe 2.05: Domain d1fwea_: 1fwe A:

Lineage for d1fwea_ (1fwe A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families)

5. Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
   automatically mapped to Pfam PF00547

6. Protein Urease, gamma-subunit [54113] (4 species)

7. Species Klebsiella aerogenes [TaxId:28451] [54114] (27 PDB entries)

8. Domain d1fwea_: 1fwe A: [37341]
   Other proteins in same PDB: d1fweb_, d1fwec1, d1fwec2
   complexed with hae, ni

Details for d1fwea_

PDB Entry: 1fwe, 2 Å

PDB Description: klebsiella aerogenes urease, c319a variant with acetohydroxamic acid (aha) bound

PDB Compounds: (A:) urease

SCOPe Domain Sequences for d1fwea_:

Sequence; same for both SEQRES and ATOM records:

>d1fwea_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes [TaxId: 28451]}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

Timeline for d1fwea_:

• d1fwea_ first appeared (with stable ids) in SCOP 1.55
  
• d1fwea_ appears in SCOPe 2.04
  
• d1fwea_ appears in SCOPe 2.06
  
• d1fwea_ appears in the current release, SCOPe 2.08