Lineage for d1fwea_ (1fwe A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188733Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
  4. 188734Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) (S)
  5. 188735Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 188736Protein Urease, gamma-subunit [54113] (3 species)
  7. 188746Species Klebsiella aerogenes [TaxId:28451] [54114] (25 PDB entries)
  8. 188761Domain d1fwea_: 1fwe A: [37341]
    Other proteins in same PDB: d1fweb_, d1fwec1, d1fwec2

Details for d1fwea_

PDB Entry: 1fwe (more details), 2 Å

PDB Description: klebsiella aerogenes urease, c319a variant with acetohydroxamic acid (aha) bound

SCOP Domain Sequences for d1fwea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwea_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

SCOP Domain Coordinates for d1fwea_:

Click to download the PDB-style file with coordinates for d1fwea_.
(The format of our PDB-style files is described here.)

Timeline for d1fwea_: