Lineage for d6hc0d_ (6hc0 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778206Family b.26.1.0: automated matches [191616] (1 protein)
    not a true family
  6. 2778207Protein automated matches [191125] (8 species)
    not a true protein
  7. 2778208Species Bdellovibrio bacteriovorus [TaxId:264462] [373359] (2 PDB entries)
  8. 2778213Domain d6hc0d_: 6hc0 D: [373408]
    automated match to d1r21a_
    complexed with fmt

Details for d6hc0d_

PDB Entry: 6hc0 (more details), 1.87 Å

PDB Description: bdellovibrio bacteriovorus dgcb fha domain, tail complex
PDB Compounds: (D:) GGDEF domain protein

SCOPe Domain Sequences for d6hc0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hc0d_ b.26.1.0 (D:) automated matches {Bdellovibrio bacteriovorus [TaxId: 264462]}
vppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
dlgstnktivngqvipplascllknndqiktgnvifkflekg

SCOPe Domain Coordinates for d6hc0d_:

Click to download the PDB-style file with coordinates for d6hc0d_.
(The format of our PDB-style files is described here.)

Timeline for d6hc0d_: