Lineage for d6hc0d_ (6hc0 D:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. Family b.26.1.0: automated matches [191616] (1 protein)
    not a true family
  6. Protein automated matches [191125] (8 species)
    not a true protein
  7. Species Bdellovibrio bacteriovorus [TaxId:264462] [373359] (2 PDB entries)
  8. Domain d6hc0d_: 6hc0 D: [373408]
    automated match to d1r21a_
    complexed with fmt

Details for d6hc0d_

PDB Entry: 6hc0 (more details), 1.87 Å

PDB Description: bdellovibrio bacteriovorus dgcb fha domain, tail complex
PDB Compounds: (D:) GGDEF domain protein

SCOPe Domain Sequences for d6hc0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hc0d_ b.26.1.0 (D:) automated matches {Bdellovibrio bacteriovorus [TaxId: 264462]}
vppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
dlgstnktivngqvipplascllknndqiktgnvifkflekg

SCOPe Domain Coordinates for d6hc0d_ are not available.

Timeline for d6hc0d_:

Domains from other chains:
(mouse over for more information)
d6hc0b_, d6hc0c_, d6hc0e_