Class b: All beta proteins [48724] (180 folds) |
Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) has a few short helices inserted in loops |
Family b.26.1.0: automated matches [191616] (1 protein) not a true family |
Protein automated matches [191125] (8 species) not a true protein |
Species Bdellovibrio bacteriovorus [TaxId:264462] [373359] (2 PDB entries) |
Domain d6hc0d_: 6hc0 D: [373408] automated match to d1r21a_ complexed with fmt |
PDB Entry: 6hc0 (more details), 1.87 Å
SCOPe Domain Sequences for d6hc0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hc0d_ b.26.1.0 (D:) automated matches {Bdellovibrio bacteriovorus [TaxId: 264462]} vppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi dlgstnktivngqvipplascllknndqiktgnvifkflekg
Timeline for d6hc0d_: