![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
![]() | Protein automated matches [190766] (8 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [373406] (1 PDB entry) |
![]() | Domain d6hd3c3: 6hd3 C:205-463 [373407] Other proteins in same PDB: d6hd3c1, d6hd3c2 automated match to d1e32a2 complexed with adp, po4 |
PDB Entry: 6hd3 (more details), 2.8 Å
SCOPe Domain Sequences for d6hd3c3:
Sequence, based on SEQRES records: (download)
>d6hd3c3 c.37.1.20 (C:205-463) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gyddvggvrkqmaqirelvelplrhpqlfksigvkppkgillygppgsgktliaravane tgafffcingpeimsklagesesnlrkafeeaeknapsiifideidsiapkrektngeve rrivsqlltlmdglksrahvivmgatnrpnsidpalrrfgrfdreidigvpdeigrlevl rihtknmklaedvdleriskdthgyvgadlaalcteaalqcirekmdvidleddsidaei lnsmavtnehfhtalgnsn
>d6hd3c3 c.37.1.20 (C:205-463) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gyddvggvrkqmaqirelvelplrhpqlfksigvkppkgillygppgsgktliaravane tgafffcingpeimsklagesesnlrkafeeaeknapsiifideidsiapkrektngeve rrivsqlltlmdglksrahvivmgatnrpnsidpalrrfgrfdreidigvpdeigrlevl rihtknmklaedvdleriskdthgyvgadlaalcteaalqcirekmdvddsidaeilnsm avtnehfhtalgnsn
Timeline for d6hd3c3: