Lineage for d6hd3c3 (6hd3 C:205-463)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870969Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2871357Protein automated matches [190766] (8 species)
    not a true protein
  7. 2871461Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [373406] (1 PDB entry)
  8. 2871462Domain d6hd3c3: 6hd3 C:205-463 [373407]
    Other proteins in same PDB: d6hd3c1, d6hd3c2
    automated match to d1e32a2
    complexed with adp, po4

Details for d6hd3c3

PDB Entry: 6hd3 (more details), 2.8 Å

PDB Description: common mode of remodeling aaa atpases p97/cdc48 by their disassembly cofactors aspl/pux1
PDB Compounds: (C:) Cell division control protein 48 homolog A

SCOPe Domain Sequences for d6hd3c3:

Sequence, based on SEQRES records: (download)

>d6hd3c3 c.37.1.20 (C:205-463) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gyddvggvrkqmaqirelvelplrhpqlfksigvkppkgillygppgsgktliaravane
tgafffcingpeimsklagesesnlrkafeeaeknapsiifideidsiapkrektngeve
rrivsqlltlmdglksrahvivmgatnrpnsidpalrrfgrfdreidigvpdeigrlevl
rihtknmklaedvdleriskdthgyvgadlaalcteaalqcirekmdvidleddsidaei
lnsmavtnehfhtalgnsn

Sequence, based on observed residues (ATOM records): (download)

>d6hd3c3 c.37.1.20 (C:205-463) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gyddvggvrkqmaqirelvelplrhpqlfksigvkppkgillygppgsgktliaravane
tgafffcingpeimsklagesesnlrkafeeaeknapsiifideidsiapkrektngeve
rrivsqlltlmdglksrahvivmgatnrpnsidpalrrfgrfdreidigvpdeigrlevl
rihtknmklaedvdleriskdthgyvgadlaalcteaalqcirekmdvddsidaeilnsm
avtnehfhtalgnsn

SCOPe Domain Coordinates for d6hd3c3:

Click to download the PDB-style file with coordinates for d6hd3c3.
(The format of our PDB-style files is described here.)

Timeline for d6hd3c3: