Lineage for d6hd3c2 (6hd3 C:111-204)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942267Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942268Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2942332Family d.31.1.0: automated matches [254296] (1 protein)
    not a true family
  6. 2942333Protein automated matches [254681] (3 species)
    not a true protein
  7. 2942374Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [373404] (1 PDB entry)
  8. 2942375Domain d6hd3c2: 6hd3 C:111-204 [373405]
    Other proteins in same PDB: d6hd3c1, d6hd3c3
    automated match to d5ftja2
    complexed with adp, po4

Details for d6hd3c2

PDB Entry: 6hd3 (more details), 2.8 Å

PDB Description: common mode of remodeling aaa atpases p97/cdc48 by their disassembly cofactors aspl/pux1
PDB Compounds: (C:) Cell division control protein 48 homolog A

SCOPe Domain Sequences for d6hd3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hd3c2 d.31.1.0 (C:111-204) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dvkygkrvhilpvddtvegvtgnlfdaylkpyfleayrpvrkgdlflvrggmrsvefkvi
etdpaeycvvapdteifcegepvkredeerlddv

SCOPe Domain Coordinates for d6hd3c2:

Click to download the PDB-style file with coordinates for d6hd3c2.
(The format of our PDB-style files is described here.)

Timeline for d6hd3c2: