Class b: All beta proteins [48724] (180 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.0: automated matches [191648] (1 protein) not a true family |
Protein automated matches [191195] (10 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [373402] (1 PDB entry) |
Domain d6hd3c1: 6hd3 C:25-110 [373403] Other proteins in same PDB: d6hd3c2, d6hd3c3 automated match to d5b6ca1 complexed with adp, po4 |
PDB Entry: 6hd3 (more details), 2.8 Å
SCOPe Domain Sequences for d6hd3c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hd3c1 b.52.2.0 (C:25-110) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} kspnrlvvdeainddnsvvslhpatmeklqlfrgdtilikgkkrkdtvcialadetceep kirmnkvvrsnlrvrlgdvisvhqcp
Timeline for d6hd3c1: