Lineage for d6hd3c1 (6hd3 C:25-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802649Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2802857Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 2802858Protein automated matches [191195] (10 species)
    not a true protein
  7. 2802923Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [373402] (1 PDB entry)
  8. 2802924Domain d6hd3c1: 6hd3 C:25-110 [373403]
    Other proteins in same PDB: d6hd3c2, d6hd3c3
    automated match to d5b6ca1
    complexed with adp, po4

Details for d6hd3c1

PDB Entry: 6hd3 (more details), 2.8 Å

PDB Description: common mode of remodeling aaa atpases p97/cdc48 by their disassembly cofactors aspl/pux1
PDB Compounds: (C:) Cell division control protein 48 homolog A

SCOPe Domain Sequences for d6hd3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hd3c1 b.52.2.0 (C:25-110) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kspnrlvvdeainddnsvvslhpatmeklqlfrgdtilikgkkrkdtvcialadetceep
kirmnkvvrsnlrvrlgdvisvhqcp

SCOPe Domain Coordinates for d6hd3c1:

Click to download the PDB-style file with coordinates for d6hd3c1.
(The format of our PDB-style files is described here.)

Timeline for d6hd3c1: