Lineage for d6gyja_ (6gyj A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. Protein automated matches [190469] (17 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [225826] (11 PDB entries)
  8. Domain d6gyja_: 6gyj A: [373392]
    automated match to d4eb4a_
    complexed with dms, fgt, so4

Details for d6gyja_

PDB Entry: 6gyj (more details), 1.7500000000000002 Å

PDB Description: mouse thymidylate synthase crystal soaked in phenolphthalein
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d6gyja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gyja_ d.117.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle
ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaey
kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng
elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk
iqlqreprpfpklkilrkvetiddfkvedfqiegynphpt

SCOPe Domain Coordinates for d6gyja_ are not available.

Timeline for d6gyja_:

Domains from other chains:
(mouse over for more information)
d6gyjb_