Lineage for d6hdub1 (6hdu B:1-180)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (206 PDB entries)
  8. 2872158Domain d6hdub1: 6hdu B:1-180 [373384]
    Other proteins in same PDB: d6hdua2, d6hdub2, d6hdud2
    automated match to d2j0vb_
    complexed with gtp, mg

Details for d6hdub1

PDB Entry: 6hdu (more details), 1.79 Å

PDB Description: crystal structure of human rab38 in complex with gtp
PDB Compounds: (B:) Ras-related protein Rab-38

SCOPe Domain Sequences for d6hdub1:

Sequence, based on SEQRES records: (download)

>d6hdub1 c.37.1.0 (B:1-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqaphkehlykllvigdlgvgktsiikryvhqnfsshyratigvdfalkvlhwdpetvvr
lqlwdiaglerfgnmtrvyyreamgafivfdvtrpatfeavakwkndldsklslpngkpv
svvllankcdqgkdvlmnnglkmdqfckehgfvgwfetsakeninideasrclvkhilan

Sequence, based on observed residues (ATOM records): (download)

>d6hdub1 c.37.1.0 (B:1-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqaphkehlykllvigdlgvgktsiikryvhqnfsshyratigvdfalkvlhwdpetvvr
lqlwdiaglerfgnmtrvyyreamgafivfdvtrpatfeavakwkndldsklslpngkpv
svvllankcdqmdqfckehgfvgwfetsakeninideasrclvkhilan

SCOPe Domain Coordinates for d6hdub1:

Click to download the PDB-style file with coordinates for d6hdub1.
(The format of our PDB-style files is described here.)

Timeline for d6hdub1: