Lineage for d6hdub1 (6hdu B:1-180)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. Protein automated matches [190123] (156 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [186862] (206 PDB entries)
  8. Domain d6hdub1: 6hdu B:1-180 [373384]
    Other proteins in same PDB: d6hdua2, d6hdub2, d6hdud2
    automated match to d2j0vb_
    complexed with gtp, mg

Details for d6hdub1

PDB Entry: 6hdu (more details), 1.7900000000000003 Å

PDB Description: crystal structure of human rab38 in complex with gtp
PDB Compounds: (B:) Ras-related protein Rab-38

SCOPe Domain Sequences for d6hdub1:

Sequence, based on SEQRES records: (download)

>d6hdub1 c.37.1.0 (B:1-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqaphkehlykllvigdlgvgktsiikryvhqnfsshyratigvdfalkvlhwdpetvvr
lqlwdiaglerfgnmtrvyyreamgafivfdvtrpatfeavakwkndldsklslpngkpv
svvllankcdqgkdvlmnnglkmdqfckehgfvgwfetsakeninideasrclvkhilan

Sequence, based on observed residues (ATOM records): (download)

>d6hdub1 c.37.1.0 (B:1-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqaphkehlykllvigdlgvgktsiikryvhqnfsshyratigvdfalkvlhwdpetvvr
lqlwdiaglerfgnmtrvyyreamgafivfdvtrpatfeavakwkndldsklslpngkpv
svvllankcdqmdqfckehgfvgwfetsakeninideasrclvkhilan

SCOPe Domain Coordinates for d6hdub1 are not available.

Timeline for d6hdub1:

Domains from same chain:
(mouse over for more information)
d6hdub2
Domains from other chains:
(mouse over for more information)
d6hdua1, d6hdua2, d6hduc_, d6hdud1, d6hdud2