Lineage for d6hdeb_ (6hde B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2406647Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2406808Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2406809Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2406963Protein automated matches [190798] (9 species)
    not a true protein
  7. 3073315Species Escherichia coli [TaxId:83333] [373377] (1 PDB entry)
  8. 3073316Domain d6hdeb_: 6hde B: [373378]
    automated match to d1rnja_
    complexed with dup, mg; mutant

Details for d6hdeb_

PDB Entry: 6hde (more details), 1.82 Å

PDB Description: structure of escherichia coli dutpase q93h mutant
PDB Compounds: (B:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d6hdeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hdeb_ b.85.4.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglidsdyhgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfdatdrgeggfghsgrq

SCOPe Domain Coordinates for d6hdeb_:

Click to download the PDB-style file with coordinates for d6hdeb_.
(The format of our PDB-style files is described here.)

Timeline for d6hdeb_:

  • d6hdeb_ is new in SCOPe 2.07-stable