Lineage for d6hava2 (6hav A:243-342)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334631Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2334632Protein automated matches [226851] (46 species)
    not a true protein
  7. 2334923Species Methanococcus aeolicus [TaxId:419665] [373340] (3 PDB entries)
  8. 2334924Domain d6hava2: 6hav A:243-342 [373373]
    Other proteins in same PDB: d6hava1
    automated match to d4jjfa2
    complexed with e4m, fe9, gol, na, scn

Details for d6hava2

PDB Entry: 6hav (more details), 1.06 Å

PDB Description: crystal structure of [fe]-hydrogenase (hmd) from methanococcus aeolicus in complex with fegp and methenyl-tetrahydromethanopterin (close form a) at 1.06 a resolution
PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d6hava2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hava2 a.100.1.0 (A:243-342) automated matches {Methanococcus aeolicus [TaxId: 419665]}
anlispvcdmgsavtapvyaailsyrdavtnilgapadfaqmmadeaitqmlelmrnegi
qnmenklnpgaltgtadsmcfgplsellpaslkvleehkk

SCOPe Domain Coordinates for d6hava2:

Click to download the PDB-style file with coordinates for d6hava2.
(The format of our PDB-style files is described here.)

Timeline for d6hava2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6hava1