Lineage for d6hbva_ (6hbv A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505518Species Sphingopyxis macrogoltabida [TaxId:33050] [373362] (2 PDB entries)
  8. 2505519Domain d6hbva_: 6hbv A: [373371]
    automated match to d3bs8a_
    complexed with mg, plp, pmp

Details for d6hbva_

PDB Entry: 6hbv (more details), 1.65 Å

PDB Description: structure of plp internal aldimine form of sphingopyxis sp. mta144 fumi protein
PDB Compounds: (A:) Aminopentol aminotransferase

SCOPe Domain Sequences for d6hbva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hbva_ c.67.1.0 (A:) automated matches {Sphingopyxis macrogoltabida [TaxId: 33050]}
gtrqkdlreraervipggmyghestrllppefpqffrralgariwdadeqpyidymcayg
pnllgyrqseieaaadaqrllgdtmtgpseimvnlaeafvgmvrhadwamfckngsdats
tamvlarahtgrktilcakgayhgaspwntphtagilasdrvhvayytyndaqslsdafk
ahdgdiaavfatpfrhevfedqalaqlefartarkccdetgallvvddvragfrvardcs
wthlgiepdlscwgkcfangypisallgsnkardaardifvtgsfwfsavpmaaaietlr
iiretpyletliasgaalragleaqsqrhglelkqtgpaqmpqiffaddpdfrigyawaa
aclkggvyvhpyhnmflsaahtvddvtetleatdrafsavlrdfaslqphpilm

SCOPe Domain Coordinates for d6hbva_:

Click to download the PDB-style file with coordinates for d6hbva_.
(The format of our PDB-style files is described here.)

Timeline for d6hbva_: