Lineage for d6agva_ (6agv A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954739Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954740Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins)
  6. 2954741Protein Peptide methionine sulfoxide reductase [55070] (4 species)
  7. 2954751Species Mouse (Mus musculus) [TaxId:10090] [255417] (2 PDB entries)
  8. 2954752Domain d6agva_: 6agv A: [373366]
    automated match to d2l90a_
    complexed with gol

Details for d6agva_

PDB Entry: 6agv (more details), 1.62 Å

PDB Description: crystal structure of apo mouse msra
PDB Compounds: (A:) Mitochondrial peptide methionine sulfoxide reductase

SCOPe Domain Sequences for d6agva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6agva_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Mouse (Mus musculus) [TaxId: 10090]}
kvisaeealpgrtepipvtakhhvsgnrtvepfpegtqmavfgmgcfwgaerkfwvlkgv
ystqvgfagghtrnptykevcsektghaevvrvvyrpehisfeellkvfwenhdptqgmr
qgndfgtqyrsavyptsavqmeaalrskeeyqkvlskhnfgpittdiregqvfyyaedyh
qqylsknpdg

SCOPe Domain Coordinates for d6agva_:

Click to download the PDB-style file with coordinates for d6agva_.
(The format of our PDB-style files is described here.)

Timeline for d6agva_: