Lineage for d1fwha_ (1fwh A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 498812Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 498813Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) (S)
  5. 498814Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 498815Protein Urease, gamma-subunit [54113] (3 species)
  7. 498826Species Klebsiella aerogenes [TaxId:28451] [54114] (27 PDB entries)
  8. 498839Domain d1fwha_: 1fwh A: [37336]
    Other proteins in same PDB: d1fwhb_, d1fwhc1, d1fwhc2

Details for d1fwha_

PDB Entry: 1fwh (more details), 2 Å

PDB Description: klebsiella aerogenes urease, c319y variant

SCOP Domain Sequences for d1fwha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwha_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

SCOP Domain Coordinates for d1fwha_:

Click to download the PDB-style file with coordinates for d1fwha_.
(The format of our PDB-style files is described here.)

Timeline for d1fwha_: