Lineage for d6hb8c1 (6hb8 C:21-265)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2619748Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2619749Protein automated matches [190857] (70 species)
    not a true protein
  7. 2620117Species Klebsiella pneumoniae [TaxId:573] [225260] (109 PDB entries)
  8. 2620235Domain d6hb8c1: 6hb8 C:21-265 [373357]
    Other proteins in same PDB: d6hb8a2, d6hb8b2, d6hb8c2, d6hb8d2
    automated match to d4s2kb_
    complexed with cl, edo, etx, gol, so4

Details for d6hb8c1

PDB Entry: 6hb8 (more details), 1.86 Å

PDB Description: crystal structure of oxa-517 beta-lactamase
PDB Compounds: (C:) Beta-lactamase

SCOPe Domain Sequences for d6hb8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hb8c1 e.3.1.0 (C:21-265) automated matches {Klebsiella pneumoniae [TaxId: 573]}
vakewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslia
ldlgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlh
afdygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamltean
gdyiiraktgystkpkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqek
iip

SCOPe Domain Coordinates for d6hb8c1:

Click to download the PDB-style file with coordinates for d6hb8c1.
(The format of our PDB-style files is described here.)

Timeline for d6hb8c1: