SCOPe 2.08: Domain d6haca2: 6hac A:243-342

Lineage for d6haca2 (6hac A:243-342)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Methanococcus aeolicus [TaxId:419665] [373340] (3 PDB entries)

8. Domain d6haca2: 6hac A:243-342 [373351]
   Other proteins in same PDB: d6haca1
   automated match to d4jjfa2
   complexed with 1pe, fe9, gol, na

Details for d6haca2

PDB Entry: 6hac, 2.3 Å

PDB Description: crystal structure of [fe]-hydrogenase (hmd) holoenzyme from methanococcus aeolicus (open form)

PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d6haca2:

Sequence; same for both SEQRES and ATOM records:

>d6haca2 a.100.1.0 (A:243-342) automated matches {Methanococcus aeolicus [TaxId: 419665]}
anlispvcdmgsavtapvyaailsyrdavtnilgapadfaqmmadeaitqmlelmrnegi
qnmenklnpgaltgtadsmcfgplsellpaslkvleehkk

Timeline for d6haca2:

• d6haca2 first appeared in SCOPe 2.07