SCOPe 2.08: Domain d6haca1: 6hac A:1-242

Lineage for d6haca1 (6hac A:1-242)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Methanococcus aeolicus [TaxId:419665] [373338] (3 PDB entries)

8. Domain d6haca1: 6hac A:1-242 [373350]
   Other proteins in same PDB: d6haca2
   automated match to d4jjfa1
   complexed with 1pe, fe9, gol, na

Details for d6haca1

PDB Entry: 6hac, 2.3 Å

PDB Description: crystal structure of [fe]-hydrogenase (hmd) holoenzyme from methanococcus aeolicus (open form)

PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d6haca1:

Sequence; same for both SEQRES and ATOM records:

>d6haca1 c.2.1.0 (A:1-242) automated matches {Methanococcus aeolicus [TaxId: 419665]}
mkvailgagcyrshaacgitnfsraaevankvgipeitmthstitmgaellhlvdeidev
vvsdpcfaeepgliiidefdckevmeahlagkaedvmpairdavkakakdspkppkgcih
fvnpekvglkvtsddreaiegadivitwlpkggsqpaiiekfvdaikegaivthactipt
pkfakifkdlgredlnivsfhpgcvpemkgqvylsegyaseeaveklykiakisrgtafk
mp

Timeline for d6haca1:

• d6haca1 first appeared in SCOPe 2.07