Lineage for d2kaua_ (2kau A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 498812Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 498813Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) (S)
  5. 498814Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 498815Protein Urease, gamma-subunit [54113] (3 species)
  7. 498826Species Klebsiella aerogenes [TaxId:28451] [54114] (27 PDB entries)
  8. 498840Domain d2kaua_: 2kau A: [37335]
    Other proteins in same PDB: d2kaub_, d2kauc1, d2kauc2
    CASP1

Details for d2kaua_

PDB Entry: 2kau (more details), 2 Å

PDB Description: the crystal structure of urease from klebsiella aerogenes at 2.2 angstroms resolution

SCOP Domain Sequences for d2kaua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kaua_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

SCOP Domain Coordinates for d2kaua_:

Click to download the PDB-style file with coordinates for d2kaua_.
(The format of our PDB-style files is described here.)

Timeline for d2kaua_: