SCOPe 2.07: Domain d6adcf1: 6adc F:1-106

Lineage for d6adcf1 (6adc F:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d6adcf1: 6adc F:1-106 [373342]
   Other proteins in same PDB: d6adca_, d6adcb_, d6adcd2, d6adcf2
   automated match to d1ikfl1
   complexed with bxa; mutant

Details for d6adcf1

PDB Entry: 6adc, 3.06 Å

PDB Description: crystal structure of the e148a mutant clc-ec1 in the presence of 50mm bromoacetate

PDB Compounds: (F:) antibody fab fragment, light chain

SCOPe Domain Sequences for d6adcf1:

Sequence; same for both SEQRES and ATOM records:

>d6adcf1 b.1.1.0 (F:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

Timeline for d6adcf1:

• d6adcf1 is new in SCOPe 2.07-stable
  
• d6adcf1 appears in the current release, SCOPe 2.08